PL-TES – 10 MG
Original price was: $126.25.$63.13Current price is: $63.13.
Third-party tested by Kovera Labs. View report
Research Specifications
- CAS Number
- 218949-48-5
- Molecular Formula
- C221H366N72O67S
- Molecular Weight
- ~5,136 g/mol
- Quantity
- 10 mg
- Purity
- 99.337%
- Form
- Lyophilized powder
- Net Content Tested
- 10.59 mg
- Identity Confirmation
- LC-MS confirmed
- Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Research Use Statement
For laboratory research use only. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease.
Certificate of Analysis
This batch was independently tested by Kovera Labs. The verification page opens on the COA — use the tabs there to view the remaining panels.
- Also in this report
- Endotoxin Analysis
- Heavy Metals Analysis
- Sterility




